PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 332aa    MW: 37105.4 Da    PI: 8.2291
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0689genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
      Gh_A13G0689 14 KGPWTPEEDQKLLAYIEQHGHGSWRALPAKAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.22.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W+ Ia++++ +Rt++++k++w+++l
      Gh_A13G0689  67 RGKFSLQEEQTIIQLHALLGNR-WSGIAAHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.971961IPR017930Myb domain
SuperFamilySSF466891.94E-3011108IPR009057Homeodomain-like
SMARTSM007174.2E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001675.55E-111661No hitNo description
PROSITE profilePS5129425.71962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2665117IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001679.49E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE QHGHGSWRAL PAKAGLQRCG KSCRLRWINY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS GIAAHLPKRT DNEIKNYWNT HLKKRLNKMG  120
IDPVTHKPKT NALGSATGNP KDAATLSHMA QWESARLEAE ARLVRESKFV GSSSSSSSSS  180
SSSAPQHTSN TVMTPPATRP QCLDVLKAWQ GLVTGLFTFN NTTDNLQSPT STLNFVENTN  240
TLANGLINEN SMELHEMGAW FRQDSSYRAV ENMNMEDYSD MMVWESGDHQ QWSSMAAPAE  300
NLNETSYGNS SSSSSSLEEN RNYWNNILNL VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26121175109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.132480.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461180.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D2VCI00.0A0A0D2VCI0_G
STRINGPOPTR_0010s17300.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2059745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.11e-108myb domain protein 106